PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma418g00090.1
Common NameZOSMA_418G00090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family EIL
Protein Properties Length: 586aa    MW: 65864.7 Da    PI: 5.2595
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma418g00090.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3379.94.1e-116423002264
                       XXXXXXXXXXXXXXXXXXXXXX..XXXXX..XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
              EIN3   2 elkkrmwkdqmllkrlkerkkqlledkeaa.tgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLra 93 
                       el+ rmwkd+++lkr+ker k+   ++  + t++++ ++s+eqarrkkmsraQDgiLkYMlk mevcna+GfvYgi  ekgkpv+g+sd+Lra
  Zosma418g00090.1  42 ELTTRMWKDRIKLKRIKERFKNISSHEALErTDNNNPKQSTEQARRKKMSRAQDGILKYMLKLMEVCNARGFVYGILLEKGKPVSGSSDNLRA 134
                       899******************95433333359999999******************************************************* PP

                       XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT- CS
              EIN3  94 WWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelgl 186
                       WWkekv+fd+n  aai +y+ +nl  ++e + ++e++ + +sl++lqD+tlgSLLs+lmqhc+ppqr+fple+gv+p WWP+  e+ww +lgl
  Zosma418g00090.1 135 WWKEKVKFDKNCLAAIENYEDENLGEAREGGWRAEGKGNFKSLMDLQDATLGSLLSSLMQHCSPPQRKFPLERGVPPQWWPSSYEDWWIKLGL 227
                       ********************9***99999999************************************************************* PP

                       -TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXX CS
              EIN3 187 skdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahs 264
                       +k    ppykkphdlkk+wkv+vLt vikhmsp+i++ir+++r+sk+lqdkm+ake  ++++vln ee  c++    s
  Zosma418g00090.1 228 PKGEV-PPYKKPHDLKKMWKVGVLTGVIKHMSPNIAKIRNHVRKSKCLQDKMTAKECSIWSEVLNCEETSCQS----S 300
                       **998.9*************************************************************98853....2 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048736.3E-11542294No hitNo description
Gene3DG3DSA:1.10.3180.103.5E-64173298IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.57E-56175295IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042762Biological Processregulation of sulfur metabolic process
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 586 aa     Download sequence    Send to blast
MEPLMMFQTN IGEGSDFEID DPSKYVDVTE NDVSDEDIEP GELTTRMWKD RIKLKRIKER  60
FKNISSHEAL ERTDNNNPKQ STEQARRKKM SRAQDGILKY MLKLMEVCNA RGFVYGILLE  120
KGKPVSGSSD NLRAWWKEKV KFDKNCLAAI ENYEDENLGE AREGGWRAEG KGNFKSLMDL  180
QDATLGSLLS SLMQHCSPPQ RKFPLERGVP PQWWPSSYED WWIKLGLPKG EVPPYKKPHD  240
LKKMWKVGVL TGVIKHMSPN IAKIRNHVRK SKCLQDKMTA KECSIWSEVL NCEETSCQSS  300
GGIRASELTD MPCSGSNNSI VGAAKNCQAS ASLRRQKKGR RREGDNIIGL SVENINSTAN  360
VEEESLAVKR PCKGSSILHD DNQSELPQLG CNMSDFEKSE CAVSGSRSQK GHAENSCLFP  420
EPTINDIPDV LTPHFSRQTD GQLLHCSGFG DVDNNPCTLC LYSSSEVHDL SHNNSQKHPI  480
PLVHQQTEEG IETTRNGGVD DSHNLEQALA FDSNSETFHE DVFQLAVDDG YKSYNVQDKL  540
VVENHQQYAS PLDYTFNCSP MNLDLENFSV DDFLHGEEIM EYLGT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A1e-6317730112136ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00649PBMTransfer from LOC_Os09g31400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008798325.11e-147PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
RefseqXP_008798326.11e-147PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLA0A0K9P5380.0A0A0K9P538_Z
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37203779
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-123ETHYLENE-INSENSITIVE3-like 3